PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009591106.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 293aa    MW: 33077.2 Da    PI: 7.5426
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009591106.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.91.1e-182471148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd llv+++ q+G g+W+  a++ g++Rt+k+c++rw++yl
   XP_009591106.1 24 RGPWTVEEDSLLVHYISQHGEGRWNMLANRAGLKRTGKSCRLRWLNYL 71
                     89********************************************97 PP

2Myb_DNA-binding52.31.3e-1677120146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T++E++l+++++ +lG++ W++Ia++++ gRt++++k++w++
   XP_009591106.1  77 RGNLTPQEQLLILELHSKLGNR-WSRIAQYLP-GRTDNEIKNYWRT 120
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.0531971IPR017930Myb domain
SuperFamilySSF466891.64E-3121118IPR009057Homeodomain-like
SMARTSM007171.0E-152373IPR001005SANT/Myb domain
PfamPF002491.9E-162471IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-232578IPR009057Homeodomain-like
CDDcd001671.17E-122671No hitNo description
PROSITE profilePS5129425.07172126IPR017930Myb domain
SMARTSM007179.9E-1576124IPR001005SANT/Myb domain
PfamPF002491.7E-1577120IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2379125IPR009057Homeodomain-like
CDDcd001671.24E-1181120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
METDISFLSK SSSSSSDDEI GLRRGPWTVE EDSLLVHYIS QHGEGRWNML ANRAGLKRTG  60
KSCRLRWLNY LKPDVKRGNL TPQEQLLILE LHSKLGNRWS RIAQYLPGRT DNEIKNYWRT  120
RVQKQARHLK IDSNSAAFQH MIRCLWIPRL LQKIQGSSAI PAMQTSQSTS LLDSQYGPLN  180
ITKLTQTPQV LSLENNSISS SRCSSSSPSS ESMSIYKSPN IISECPKIPP LEMGDSDLNS  240
FAHFPFEDNS YGMDTFSSAT GNFLNNYDQM VGGENNLMNG DILADSLWSM DQF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-27221265108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ5389493e-89AJ538949.1 Nicotiana tabacum cDNA-AFLP-fragment BT3-M23-017.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009591106.10.0PREDICTED: transcription factor MYB57-like
TrEMBLM1A4481e-113M1A448_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000143831e-113(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.11e-74myb domain protein 62